PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG429100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 241aa    MW: 26277.2 Da    PI: 4.9541
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG429100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-193185256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Pavir.2NG429100.1.p 31 KNKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 85
                         67789*************************************************9 PP

2HD-ZIP_I/II121.83.3e-3932123293
          HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                          +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal  + e+L+ke+++L ++l
  Pavir.2NG429100.1.p  32 NKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLCSYESLKKEKHALLKQL 121
                          79*************************************************************************************999 PP

          HD-ZIP_I/II  92 ke 93 
                          ++
  Pavir.2NG429100.1.p 122 EK 123
                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-191888IPR009057Homeodomain-like
SuperFamilySSF466895.99E-192589IPR009057Homeodomain-like
PROSITE profilePS5007117.2652787IPR001356Homeobox domain
SMARTSM003891.9E-163091IPR001356Homeobox domain
PfamPF000465.1E-173185IPR001356Homeobox domain
CDDcd000862.59E-163188No hitNo description
PRINTSPR000317.8E-65867IPR000047Helix-turn-helix motif
PROSITE patternPS0002706285IPR017970Homeobox, conserved site
PRINTSPR000317.8E-66783IPR000047Helix-turn-helix motif
PfamPF021836.4E-1387129IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEGEDDVPEW MMEVGGGGGG KGKGGGGGLD KNKKRFSEEQ IKSLESMFAT QTKLEPRQKL  60
QLARELGLQP RQVAIWFQNK RARWKSKQLE REYSALRDDY DALLCSYESL KKEKHALLKQ  120
LEKLAEMLQE PRGKYGGNAG AGAGEDVRPG VGGMKEEFAD AGAGLYSSEA AADGGKFAHF  180
ADDDAGALFR PSPQQPAAGF TASGPPEHQP FQFQSSCWPS STTEQTCSSS QWWEFESLSE  240
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11826GGKGKGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.17130.0callus| leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0872580.0BT087258.1 Zea mays full-length cDNA clone ZM_BFb0020F23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957433.11e-149PREDICTED: homeobox-leucine zipper protein HOX6-like
SwissprotQ651Z54e-95HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH354e-95HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLK3ZWK11e-149K3ZWK1_SETIT; Uncharacterized protein
STRINGSi030983m1e-149(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78733448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.13e-43homeobox 7